제품 상세정보
Place of Origin: China
브랜드 이름: Hongbaiyi
인증: COA, HPLC MR
Model Number: HBY-LL-37 (Human)
문서: 제품 설명서 PDF
지불과 운송 용어
Minimum Order Quantity: 5 boxes
가격: negotiable
Packaging Details: 50mg/vial, 10vials/box
Delivery Time: 3-5 work days after your payment
Payment Terms: MoneyGram, Western Union, T/T
Supply Ability: 5000 boxes per month
Name: |
LL-37 (Human) |
CAS: |
154947-66-7 |
MF: |
C205H340N60O53 |
MW: |
/ |
Purity: |
>98%+ |
Form: |
white Lyophillized powder |
Storage: |
Cool Dry Place |
Shelf Life: |
2 years |
Name: |
LL-37 (Human) |
CAS: |
154947-66-7 |
MF: |
C205H340N60O53 |
MW: |
/ |
Purity: |
>98%+ |
Form: |
white Lyophillized powder |
Storage: |
Cool Dry Place |
Shelf Life: |
2 years |
98%+ Purity LL-37 (Human) CAS 154947-66-7 50mg Antimicrobial Peptides
Description of LL-37 (human)
LL-37 (human) is a 37-amino acid host defense peptide with a remarkable range of biological activities. Derived from human cathelicidin, it's known for its powerful antimicrobial, antitumor, and antiviral properties, along with significant immunomodulatory effects.
Beyond fighting infections, LL-37 plays a crucial role in various physiological processes, including wound healing, angiogenesis, and cell signaling. However, its complex nature means it also impacts the progression of autoimmune and inflammatory diseases like lupus, rheumatoid arthritis, and atherosclerosis. Emerging research also highlights its involvement in Alzheimer's disease and its dual role in various human cancers.
Basic Information Form:
Other Names | Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human) |
---|---|
Three Letter Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
Molecular Weight | 4493.3 |
Molecular Formula | C205H340N60O53 |
Sequence | [LL-37, 37 aa] |
Solubility | Soluble in water |
Appearance | Freeze-dried solid |
Storage | Store dry, dark, and frozen |
Purity | >95% by HPLC |
Product Picture Of CJC 1295 Without DAC